Structure of PDB 1hjc Chain A Binding Site BS02

Receptor Information
>1hjc Chain A (length=118) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGN
DENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQV
ATYHRAIKITVDGPREPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hjc Structural Analyses of DNA Recognition by the Aml1/Runx-1 Runt Domain and its Allosteric Control by Cbfbeta
Resolution2.65 Å
Binding residue
(original residue number in PDB)		R139 R142 G143 K167 T169 V170 D171
Binding residue
(residue number reindexed from 1)		R80 R83 G84 K108 T110 V111 D112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005524 ATP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hjc, PDBe:1hjc, PDBj:1hjc
PDBsum1hjc
PubMed11257229
UniProtQ03347|RUNX1_MOUSE Runt-related transcription factor 1 (Gene Name=Runx1)

[Back to BioLiP]