Structure of PDB 1hf0 Chain A Binding Site BS02

Receptor Information
>1hf0 Chain A (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNL
SFKNMSKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEI
TMIADQLNMEKEVIRVWFSNRRQKEKRI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hf0 Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
Resolution2.7 Å
Binding residue
(original residue number in PDB)		S43 T45 T46 R49 S56 N59 R102 R105 R153 Q154 K157
Binding residue
(residue number reindexed from 1)		S38 T40 T41 R44 S51 N54 R71 R74 R122 Q123 K126
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hf0, PDBe:1hf0, PDBj:1hf0
PDBsum1hf0
PubMed11583619
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]