Structure of PDB 1h9t Chain A Binding Site BS02

Receptor Information

>1h9t Chain A (length=232) Species: 562 (Escherichia coli)

AQSPAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQR
LARDGWLTIQHGKPTKVNNFWETSGLNILETLARLDHESVPQLIDNLLSV
RTNISTIFIRTAFRQHPDKAQEVLATANEVADHADAFAELDYNIFRGLAF
ASGNPIYGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSALCSEGA
HDQVYETVRRYGHESGEIWHRMQKNLLAIQGR

Ligand information

>1h9t Chain Y (length=19)

gatctggtcgtaccagatg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1h9t The Structural Basis of Acyl Coenzyme A-Dependent Regulation of the Transcription Factor Fadr
• Resolution: 3.25 Å
• Binding residue (original residue number in PDB): A33 E34 R35 R45 R49 I63 Q64 H65 G66 K67
• Binding residue (residue number reindexed from 1): A29 E30 R31 R41 R45 I59 Q60 H61 G62 K63
• Binding affinity: PDBbind-CN: Kd=0.2nM

Gene Ontology

Molecular Function

• GO:0000062 fatty-acyl-CoA binding
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0042803 protein homodimerization activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006631 fatty acid metabolic process
• GO:0019217 regulation of fatty acid metabolic process
• GO:0045723 positive regulation of fatty acid biosynthetic process
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1h9t, PDBe:1h9t, PDBj:1h9t
• PDBsum: 1h9t
• PubMed: 11296236
• UniProt: P0A8V6|FADR_ECOLI Fatty acid metabolism regulator protein (Gene Name=fadR)