Structure of PDB 1h9d Chain A Binding Site BS02

Receptor Information
>1h9d Chain A (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLV
TVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVF
TNPPQVATYHRAIKITVDGPREPRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h9d The Leukemia-Associated Aml1 (Runx1)-Cbfbeta Complex Functions as a DNA-Induced Molecular Clamp
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R142 G143 K167 T169 V170 D171
Binding residue
(residue number reindexed from 1)		R89 G90 K114 T116 V117 D118
Binding affinityPDBbind-CN: Kd=10pM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005524 ATP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1h9d, PDBe:1h9d, PDBj:1h9d
PDBsum1h9d
PubMed11276260
UniProtQ01196|RUNX1_HUMAN Runt-related transcription factor 1 (Gene Name=RUNX1)

[Back to BioLiP]