Structure of PDB 1h8a Chain A Binding Site BS02

Receptor Information
>1h8a Chain A (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKK
VEQLSRELSTLRNLFKQL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h8a Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
Resolution2.23 Å
Binding residue
(original residue number in PDB)		R280 K287 S288 K291
Binding residue
(residue number reindexed from 1)		R14 K21 S22 K25
Binding affinityPDBbind-CN: Kd=25.4nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1h8a, PDBe:1h8a, PDBj:1h8a
PDBsum1h8a
PubMed11792321
UniProtP17676|CEBPB_HUMAN CCAAT/enhancer-binding protein beta (Gene Name=CEBPB)

[Back to BioLiP]