Structure of PDB 1gxp Chain A Binding Site BS02

Receptor Information
>1gxp Chain A (length=103) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSR
EQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFS
TRF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gxp Tandem DNA Recognition by Two-Component Signal Transduction Transcriptional Activator Phob
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R176 R193 R200 T217 R219 G220 Y223
Binding residue
(residue number reindexed from 1)		R50 R67 R74 T91 R93 G94 Y97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1gxp, PDBe:1gxp, PDBj:1gxp
PDBsum1gxp
PubMed12015152
UniProtP0AFJ5|PHOB_ECOLI Phosphate regulon transcriptional regulatory protein PhoB (Gene Name=phoB)

[Back to BioLiP]