Structure of PDB 1gu5 Chain A Binding Site BS02

Receptor Information
>1gu5 Chain A (length=65) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKV
EQLSRELSTLRNLFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gu5 Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
Resolution2.1 Å
Binding residue
(original residue number in PDB)
R280 A284 K287 S288 R289
Binding residue
(residue number reindexed from 1)
R13 A17 K20 S21 R22
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1gu5, PDBe:1gu5, PDBj:1gu5
PDBsum1gu5
PubMed
UniProtP17676|CEBPB_HUMAN CCAAT/enhancer-binding protein beta (Gene Name=CEBPB)

[Back to BioLiP]
Application loaded.