Structure of PDB 1gji Chain A Binding Site BS02

Receptor Information

>1gji Chain A (length=275) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PYIEIFEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNKTFPSIQILNYFG
KVKIRTTLVTKNEPYKPHPHDLVGKDCRDGYYEAEFGPERRVLSFQNLGI
QCVKKKDLKESISLRISKKINPFNVPEEQLHNIDEYDLNVVRLCFQAFLP
DEHGNYTLALPPLISNPIYDNRAPNTAELRICRVNKNCGSVKGGDEIFIL
CDKVQKDDIEVRFVLDNWEAKGSFSQADVHRQVAIVFRTPPFLRDITEPI
TVKMQLRRPSDQEVSEPMDFRYLPD

Ligand information

>1gji Chain D (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tctggaatttctttaaaccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1gji X-ray crystal structure of proto-oncogene product c-Rel bound to the CD28 response element of IL-2.
Resolution	2.85 Å
Binding residue (original residue number in PDB)	R21 R23 S30
Binding residue (residue number reindexed from 1)	R15 R17 S24
Binding affinity	PDBbind-CN: Kd=25nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1gji, PDBe:1gji, PDBj:1gji
PDBsum	1gji
PubMed	11587641
UniProt	P16236\|REL_CHICK Proto-oncogene c-Rel (Gene Name=REL)

[Back to BioLiP]