Structure of PDB 1gcc Chain A Binding Site BS02

Receptor Information

>1gcc Chain A (length=63) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRM
RGSRALLNFPLRV

Ligand information

>1gcc Chain C (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gctggcggcta

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1gcc A novel mode of DNA recognition by a beta-sheet revealed by the solution structure of the GCC-box binding domain in complex with DNA.
Resolution	N/A
Binding residue (original residue number in PDB)	Y146 R147 G148 R150 R152 R162 P164 Y186
Binding residue (residue number reindexed from 1)	Y3 R4 G5 R7 R9 R19 P21 Y43

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0009873	ethylene-activated signaling pathway

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1gcc, PDBe:1gcc, PDBj:1gcc
PDBsum	1gcc
PubMed	9736626
UniProt	O80337\|EF100_ARATH Ethylene-responsive transcription factor 1A (Gene Name=ERF1A)

[Back to BioLiP]