Structure of PDB 1gau Chain A Binding Site BS02

Receptor Information
>1gau Chain A (length=60) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDG
IQTRNRKVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gau NMR structure of a specific DNA complex of Zn-containing DNA binding domain of GATA-1.
ResolutionN/A
Binding residue
(original residue number in PDB)		T16 L17 A30 L33 Y34 L37 H38 M46 R47 Q52 T53 R56
Binding residue
(residue number reindexed from 1)		T16 L17 A30 L33 Y34 L37 H38 M46 R47 Q52 T53 R56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1gau, PDBe:1gau, PDBj:1gau
PDBsum1gau
PubMed8332909
UniProtP17678|GATA1_CHICK Erythroid transcription factor (Gene Name=GATA1)

[Back to BioLiP]