Structure of PDB 1ga5 Chain A Binding Site BS02

Receptor Information
>1ga5 Chain A (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCSIV
RINRNRCQQCRFKKCLSVGMSRDAVRFGRIPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ga5 DNA Deformability as a Recognition Feature in the RevErb Response Element
Resolution2.4 Å
Binding residue
(original residue number in PDB)		E19 G20 F24 R27 R50 N51 Q54 R57 F73 G74 R75 P77
Binding residue
(residue number reindexed from 1)		E22 G23 F27 R30 R54 N55 Q58 R61 F77 G78 R79 P81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ga5, PDBe:1ga5, PDBj:1ga5
PDBsum1ga5
PubMed11669620
UniProtP20393|NR1D1_HUMAN Nuclear receptor subfamily 1 group D member 1 (Gene Name=NR1D1)

[Back to BioLiP]