Structure of PDB 1g1x Chain A Binding Site BS02

Receptor Information
>1g1x Chain A (length=98) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAY
PIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFL
Ligand information
>1g1x Chain I (length=41) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaggcggccgaaaggcuagacggugggagagggugguggaa
......<<<....>>>.........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g1x Structure of the S15,S6,S18-rRNA complex: assembly of the 30S ribosome central domain.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R36 E38
Binding residue
(residue number reindexed from 1)		R36 E38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1g1x, PDBe:1g1x, PDBj:1g1x
PDBsum1g1x
PubMed10753109
UniProtQ5SLP8|RS6_THET8 Small ribosomal subunit protein bS6 (Gene Name=rpsF)

[Back to BioLiP]