Structure of PDB 1fjl Chain A Binding Site BS02

Receptor Information
>1fjl Chain A (length=65) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWF
QNRRARLRKQHTSVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1fjl High resolution crystal structure of a paired (Pax) class cooperative homeodomain dimer on DNA.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R2 R5 Y25 R31 R53 R57
Binding residue
(residue number reindexed from 1)		R3 R6 Y26 R32 R54 R58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1fjl, PDBe:1fjl, PDBj:1fjl
PDBsum1fjl
PubMed7671301
UniProtP06601|PRD_DROME Segmentation protein paired (Gene Name=prd)

[Back to BioLiP]