Structure of PDB 1feu Chain A Binding Site BS02

Receptor Information
>1feu Chain A (length=185) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEYRLKAYYREGEKPSALRRAGKLPGLMYNRHLNRKVYVDLVEFDKVFRQ
ASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYV
PLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSL
HASDLKLPPGVELAVSPEETIAAVVPPEDVEKLAE
Ligand information
>1feu Chain C (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccccaugcgagaguagggaac
.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1feu Structure of ribosomal protein TL5 complexed with RNA provides new insights into the CTC family of stress proteins.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K14 R20 Y29 N30 R31 R72 Q73 F89
Binding residue
(residue number reindexed from 1)		K14 R20 Y29 N30 R31 R72 Q73 F89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1feu, PDBe:1feu, PDBj:1feu
PDBsum1feu
PubMed11418764
UniProtP56930|RL25_THETH Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]