Structure of PDB 1eyu Chain A Binding Site BS02

Receptor Information
>1eyu Chain A (length=156) Species: 585 (Proteus vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHPDLNKLLELWPHIQEYQDLALKHGINDIFQDNGGKLLQVLLITGLTVL
PGREGNDAVDNAGQEYELKSINIDLTKGFSTHHHMNPVIIAKYRQVPWIF
AIYRGIAIEAIYRLEPKDLEFYYDKWERKWYSDGHKDINNPKIPVKYVME
HGTKIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1eyu PvuII endonuclease contains two calcium ions in active sites.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		D34 N35 E55 N57 K70 S71 N73 L76 S81 T82 H83 H84 K93 N141 K143
Binding residue
(residue number reindexed from 1)		D33 N34 E54 N56 K69 S70 N72 L75 S80 T81 H82 H83 K92 N140 K142
Enzymatic activity
Catalytic site (original residue number in PDB) D58 E68 K70
Catalytic site (residue number reindexed from 1) D57 E67 K69
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1eyu, PDBe:1eyu, PDBj:1eyu
PDBsum1eyu
PubMed10903853
UniProtP23657|T2P2_PROHU Type II restriction enzyme PvuII (Gene Name=pvuIIR)

[Back to BioLiP]