Structure of PDB 1eyg Chain A Binding Site BS02

Receptor Information
>1eyg Chain A (length=112) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKE
QTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTE
VVVNVGGTMQML
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1eyg Structure of the DNA binding domain of E. coli SSB bound to ssDNA.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R1021 M1023 N1031 T1033 S1037 E1038 S1039 W1040 E1050 Q1051 T1052 E1053 W1054 R1056 F1060 K1073 R1084 T1085 R1086 W1088 Y1097 T1098
Binding residue
(residue number reindexed from 1)		R21 M23 N31 T33 S37 E38 S39 W40 E50 Q51 T52 E53 W54 R56 F60 K73 R84 T85 R86 W88 Y97 T98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1eyg, PDBe:1eyg, PDBj:1eyg
PDBsum1eyg
PubMed10932248
UniProtP0AGE0|SSB_ECOLI Single-stranded DNA-binding protein (Gene Name=ssb)

[Back to BioLiP]