Structure of PDB 1ewn Chain A Binding Site BS02

Receptor Information

>1ewn Chain A (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETQAYLGPE
DEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACVLL
RALEPLEGLETMRQLRSTVLKDRELCSGPSKLCQALAINKSFDQRDLAQD
EAVWLERGPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQD

Ligand information

>1ewn Chain E (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcaatcatgtca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ewn Molecular basis for discriminating between normal and damaged bases by the human alkyladenine glycosylase, AAG.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	R141 T143 R145 Y162 G163 M164
Binding residue (residue number reindexed from 1)	R60 T62 R64 Y81 G82 M83

Enzymatic activity

Enzyme Commision number

3.2.2.21: DNA-3-methyladenine glycosylase II.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003824	catalytic activity
GO:0003905	alkylbase DNA N-glycosylase activity

	Biological Process
GO:0006284	base-excision repair

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1ewn, PDBe:1ewn, PDBj:1ewn
PDBsum	1ewn
PubMed	11106395
UniProt	P29372\|3MG_HUMAN DNA-3-methyladenine glycosylase (Gene Name=MPG)

[Back to BioLiP]