Structure of PDB 1e7j Chain A Binding Site BS02

Receptor Information
>1e7j Chain A (length=74) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKS
EWEAKAAKAKDDYDRAVKEFEANG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1e7j Hmg-D Complexed to a Bulge DNA: An NMR Model
Resolution Å
Binding residue
(original residue number in PDB)		Y12 W43
Binding residue
(residue number reindexed from 1)		Y12 W43
Binding affinityPDBbind-CN: Kd=1uM
Enzymatic activity
Enzyme Commision number ?
External links