Structure of PDB 1di2 Chain A Binding Site BS02

Receptor Information

>1di2 Chain A (length=69) Species: 8355 (Xenopus laevis)

MPVGSLQELAVQKGWRLPEYTVAQESGPPHKREFTITCRVETFVETGSGT
SKQVAKRVAAEKLLTKFKT

Ligand information

>1di2 Chain D (length=10)

ggcgcgcgcc

..........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1di2 Molecular basis of double-stranded RNA-protein interactions: structure of a dsRNA-binding domain complexed with dsRNA.
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): P140 F145 T161 S162 K163
• Binding residue (residue number reindexed from 1): P29 F34 T50 S51 K52

External links

• PDB: RCSB:1di2, PDBe:1di2, PDBj:1di2
• PDBsum: 1di2
• PubMed: 9857205
• UniProt: Q91836|PRKAB_XENLA Interferon-inducible double-stranded RNA-dependent protein kinase activator A homolog B (Gene Name=prkra-b)