Structure of PDB 1ddn Chain A Binding Site BS02

Receptor Information
>1ddn Chain A (length=118) Species: 1717 (Corynebacterium diphtheriae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDG
LVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEAD
RWEHVMSDEVERRLVKVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ddn Structure of the metal-ion-activated diphtheria toxin repressor/tox operator complex.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
T7 Q36 S37 P39 T40 Q43 R47 R50
Binding residue
(residue number reindexed from 1)
T5 Q34 S35 P37 T38 Q41 R45 R48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0017124 SH3 domain binding
GO:0042802 identical protein binding
GO:0046914 transition metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1ddn, PDBe:1ddn, PDBj:1ddn
PDBsum1ddn
PubMed9697776
UniProtP0DJL7|DTXR_CORDI Diphtheria toxin repressor (Gene Name=dtxR)

[Back to BioLiP]