Structure of PDB 1ddl Chain A Binding Site BS02

Receptor Information
>1ddl Chain A (length=188) Species: 70821 (Desmodium yellow mottle virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEQDKILAHQASLNTKPSLLPPPVGNPPPVISYPFQITLASLGTEDAADS
VSIASNSVLATYTALYRHAQLKHLKATIHPTYMAPKYPTSVALVWVPANS
TATSTQVLDTYGGLHFCIGGSVNSVKPIDVEANLTNLNPIIKASTTFTDT
PKLLYYSKAQATAPTSPTCYLTIQGQIELSSPLLQASS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ddl Refined structure of desmodium yellow mottle tymovirus at 2.7 A resolution.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		L93 V94 W95 V107 T110 Y111 G112 G113 L114 V130 E131 N133 N136
Binding residue
(residue number reindexed from 1)		L93 V94 W95 V107 T110 Y111 G112 G113 L114 V130 E131 N133 N136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Cellular Component
GO:0019028 viral capsid
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1ddl, PDBe:1ddl, PDBj:1ddl
PDBsum1ddl
PubMed10966774
UniProtO89511

[Back to BioLiP]