Structure of PDB 1d66 Chain A Binding Site BS02

Receptor Information
>1d66 Chain A (length=57) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEV
ESRLERL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1d66 DNA recognition by GAL4: structure of a protein-DNA complex.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R15 K18 K20 K23 K43 L49
Binding residue
(residue number reindexed from 1)		R8 K11 K13 K16 K36 L42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1d66, PDBe:1d66, PDBj:1d66
PDBsum1d66
PubMed1557122
UniProtP04386|GAL4_YEAST Regulatory protein GAL4 (Gene Name=GAL4)

[Back to BioLiP]