Structure of PDB 1cqt Chain A Binding Site BS02

Receptor Information
>1cqt Chain A (length=134) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFE
ALNLSFKNMCKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPT
SEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cqt Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		F42 S43 T46 R49 S56 N59 R105 K125 R146 R153 Q154 K157
Binding residue
(residue number reindexed from 1)		F41 S42 T45 R48 S55 N58 R78 K98 R119 R126 Q127 K130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cqt, PDBe:1cqt, PDBj:1cqt
PDBsum1cqt
PubMed10541551
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]