Structure of PDB 1ckt Chain A Binding Site BS02

Receptor Information
>1ckt Chain A (length=71) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEK
GKFEDMAKADKARYEREMKTY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ckt Basis for recognition of cisplatin-modified DNA by high-mobility-group proteins.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		M12 A16 Q20 R23 F37
Binding residue
(residue number reindexed from 1)		M6 A10 Q14 R17 F31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1ckt, PDBe:1ckt, PDBj:1ckt
PDBsum1ckt
PubMed10385126
UniProtP63159|HMGB1_RAT High mobility group protein B1 (Gene Name=Hmgb1)

[Back to BioLiP]