Structure of PDB 1cit Chain A Binding Site BS02

Receptor Information

>1cit Chain A (length=89) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKYICLANKDCPVDKR
RRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKP

Ligand information

>1cit Chain C (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgcatgaccttttcgg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1cit DNA-binding mechanism of the monomeric orphan nuclear receptor NGFI-B.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	E250 G251 F255 R258 R281 N282 R288 R310 R311 G312 R313 P315 S316 K317
Binding residue (residue number reindexed from 1)	E21 G22 F26 R29 R52 N53 R59 R81 R82 G83 R84 P86 S87 K88
Binding affinity	PDBbind-CN: Kd=1nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1cit, PDBe:1cit, PDBj:1cit
PDBsum	1cit
PubMed	10331876
UniProt	P22829\|NR4A1_RAT Nuclear receptor subfamily 4 group A member 1 (Gene Name=Nr4a1)

[Back to BioLiP]