Structure of PDB 1cf7 Chain A Binding Site BS02

Receptor Information
>1cf7 Chain A (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVL
EGIGLIEKKSKNSIQWK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cf7 Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R17 R56 Y59 K76 N77
Binding residue
(residue number reindexed from 1)		R2 R41 Y44 K61 N62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1cf7, PDBe:1cf7, PDBj:1cf7
PDBsum1cf7
PubMed10090723
UniProtQ16254|E2F4_HUMAN Transcription factor E2F4 (Gene Name=E2F4)

[Back to BioLiP]