Structure of PDB 1cdw Chain A Binding Site BS02

Receptor Information
>1cdw Chain A (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPR
TTALIFSSGKMVCTGAKSEENSRLAARKYARVVQKLGFPAKFLDFKIQNM
VGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSG
KVVLTGAKVRAEIYEAFENIYPILKGFRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cdw Crystal structure of a human TATA box-binding protein/TATA element complex.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Q162 N163 R192 F193 I197 R199 R204 T206 L208 T218 V255 F284 P285 F301 S303 K305 V307
Binding residue
(residue number reindexed from 1)		Q8 N9 R38 F39 I43 R45 R50 T52 L54 T64 V101 F130 P131 F147 S149 K151 V153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cdw, PDBe:1cdw, PDBj:1cdw
PDBsum1cdw
PubMed8643494
UniProtP20226|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]