Structure of PDB 1c7u Chain A Binding Site BS02

Receptor Information
>1c7u Chain A (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLADAEIALIIFNSS
NKLFQYASTDMDKVLLKYTEYNEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1c7u Solution structure of the MEF2A-DNA complex: structural basis for the modulation of DNA bending and specificity by MADS-box transcription factors
ResolutionN/A
Binding residue
(original residue number in PDB)		G1 K3 I5 N15 T19 K22 R23 G26 K29 K30 E33
Binding residue
(residue number reindexed from 1)		G1 K3 I5 N15 T19 K22 R23 G26 K29 K30 E33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1c7u, PDBe:1c7u, PDBj:1c7u
PDBsum1c7u
PubMed10835359
UniProtQ02078|MEF2A_HUMAN Myocyte-specific enhancer factor 2A (Gene Name=MEF2A)

[Back to BioLiP]