Structure of PDB 1bua Chain A Binding Site BS02

Receptor Information
>1bua Chain A (length=231) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPI
INKIAEKHGYIVEEPQQNHYPDFTLYKPSEPNKKIAIDIKTTYTEKIKFT
LGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVKTYNINELNEIPKPY
KGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFL
DYWRNYERTSQLRNDKYNNISEYRNWIYRGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bua Structural and energetic origins of indirect readout in site-specific DNA cleavage by a restriction endonuclease.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		Q69 S183 G184 N185 S223
Binding residue
(residue number reindexed from 1)		Q67 S170 G171 N172 S210
Binding affinityPDBbind-CN: Kd=550nM
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1bua, PDBe:1bua, PDBj:1bua
PDBsum1bua
PubMed10074946
UniProtP04390|T2E5_ECOLX Type II restriction enzyme EcoRV (Gene Name=ecoRVR)

[Back to BioLiP]