Structure of PDB 1bt6 Chain A Binding Site BS02

Receptor Information
>1bt6 Chain A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLA
VDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bt6 The crystal structure of a complex of p11 with the annexin II N-terminal peptide.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		F41 N44 Q45 C82 Y85 M90
Binding residue
(residue number reindexed from 1)		F41 N44 Q45 C82 Y85 M90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0042803 protein homodimerization activity
GO:0044325 transmembrane transporter binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0001765 membrane raft assembly
GO:0006900 vesicle budding from membrane
GO:0010756 positive regulation of plasminogen activation
GO:0042789 mRNA transcription by RNA polymerase II
GO:0043547 positive regulation of GTPase activity
GO:0045921 positive regulation of exocytosis
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050767 regulation of neurogenesis
GO:0051496 positive regulation of stress fiber assembly
GO:0051894 positive regulation of focal adhesion assembly
GO:0072659 protein localization to plasma membrane
GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
GO:1905686 positive regulation of plasma membrane repair
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0016363 nuclear matrix
GO:0045121 membrane raft
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0090575 RNA polymerase II transcription regulator complex
GO:0098797 plasma membrane protein complex
GO:1990665 AnxA2-p11 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bt6, PDBe:1bt6, PDBj:1bt6
PDBsum1bt6
PubMed9886297
UniProtP60903|S10AA_HUMAN Protein S100-A10 (Gene Name=S100A10)

[Back to BioLiP]