Structure of PDB 1bnk Chain A Binding Site BS02

Receptor Information

>1bnk Chain A (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KGHLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLG
PEDEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACV
LLRALEPLEGLETMRQLRSRVLKDRELCSGPSKLCQALAINKSFDQRDLA
QDEAVWLERAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQD

Ligand information

>1bnk Chain E (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggcaatcatgtca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1bnk Crystal structure of a human alkylbase-DNA repair enzyme complexed to DNA: mechanisms for nucleotide flipping and base excision.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	R141 T143 R145 Y162 M164
Binding residue (residue number reindexed from 1)	R62 T64 R66 Y83 M85

Enzymatic activity

Enzyme Commision number

3.2.2.21: DNA-3-methyladenine glycosylase II.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003824	catalytic activity
GO:0003905	alkylbase DNA N-glycosylase activity

	Biological Process
GO:0006284	base-excision repair

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1bnk, PDBe:1bnk, PDBj:1bnk
PDBsum	1bnk
PubMed	9790531
UniProt	P29372\|3MG_HUMAN DNA-3-methyladenine glycosylase (Gene Name=MPG)

[Back to BioLiP]