Structure of PDB 1bhm Chain A Binding Site BS02

Receptor Information
>1bhm Chain A (length=198) Species: 1390 (Bacillus amyloliquefaciens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEVEKEFITDEAKELLSKDKLIQQAYNEVKTSICSPIWPATSKTFTINNT
EKNCNGVVPIKELCYTLLEDTYNWYREKPLDILKLEKKKGGPIDVYKEFI
ENSELKRVGMEFETGNISSAHRSMNKLLLGLKHGEIDLAIILMPIKQLAY
YLTDRVTNFEELEPYFELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bhm Structure of Bam HI endonuclease bound to DNA: partial folding and unfolding on DNA binding.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		V57 K61 K89 G90 G91 T114 N116 R122 K126 T153 D154 R155 K193 G194 D196 G197 M198
Binding residue
(residue number reindexed from 1)		V57 K61 K89 G90 G91 T114 N116 R122 K126 T153 D154 R155 K193 G194 D196 G197 M198
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1bhm, PDBe:1bhm, PDBj:1bhm
PDBsum1bhm
PubMed7624794
UniProtP23940|T2BA_BACAM Type II restriction enzyme BamHI (Gene Name=bamHIR)

[Back to BioLiP]