Structure of PDB 1bf4 Chain A Binding Site BS02

Receptor Information
>1bf4 Chain A (length=63) Species: 2285 (Sulfolobus acidocaldarius) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDA
PKELLQMLEKQKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bf4 The crystal structure of the hyperthermophile chromosomal protein Sso7d bound to DNA.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Y8 K9 K28 M29 A45 S47
Binding residue
(residue number reindexed from 1)		Y7 K8 K27 M28 A44 S46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004521 RNA endonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:1bf4, PDBe:1bf4, PDBj:1bf4
PDBsum1bf4
PubMed9731772
UniProtP13123|DN7D_SULAC DNA-binding protein 7d (Gene Name=Saci_0064)

[Back to BioLiP]