Structure of PDB 1b8i Chain A Binding Site BS02

Receptor Information
>1b8i Chain A (length=62) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FYPWMARQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIW
FQNRRMKLKKEI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b8i Structure of a DNA-bound Ultrabithorax-Extradenticle homeodomain complex.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R105 Q106 Y108 R143 Q144 I147 N151 K155
Binding residue
(residue number reindexed from 1)		R7 Q8 Y10 R45 Q46 I49 N53 K57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1b8i, PDBe:1b8i, PDBj:1b8i
PDBsum1b8i
PubMed10067897
UniProtP83949|UBX_DROME Homeotic protein ultrabithorax (Gene Name=Ubx)

[Back to BioLiP]