Structure of PDB 1b72 Chain A Binding Site BS02

Receptor Information
>1b72 Chain A (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARTFDWMKVLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQ
VKIWFQNRRMKQKKRERE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b72 Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		Y227 R233 Q252 R255 M256 K259
Binding residue
(residue number reindexed from 1)		Y31 R37 Q56 R59 M60 K63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1b72, PDBe:1b72, PDBj:1b72
PDBsum1b72
PubMed10052460
UniProtP14653|HXB1_HUMAN Homeobox protein Hox-B1 (Gene Name=HOXB1)

[Back to BioLiP]