Structure of PDB 1b69 Chain A Binding Site BS02

Receptor Information
>1b69 Chain A (length=69) Species: 1351 (Enterococcus faecalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPA
GKRDAISLREKIAELQKDI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b69 NMR structure of the Tn916 integrase-DNA complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		R24 K28 F38 Y40
Binding residue
(residue number reindexed from 1)		R22 K26 F36 Y38
Binding affinityPDBbind-CN: Kd=151nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008907 integrase activity
Biological Process
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1b69, PDBe:1b69, PDBj:1b69
PDBsum1b69
PubMed10201406
UniProtP22886|TNR6_ENTFL Transposase from transposon Tn916 (Gene Name=Int-Tn)

[Back to BioLiP]