Structure of PDB 1b3t Chain A Binding Site BS02

Receptor Information
>1b3t Chain A (length=147) Species: 10376 (human gammaherpesvirus 4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVY
GGSKTSLYNLRRGTALAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVC
YFMVFLQTHIFAEVLKDAIKDLVMTKPAPTCNIRVTVCSFDDGVDLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b3t The 2.2 A structure of a permanganate-sensitive DNA site bound by the Epstein-Barr virus origin binding protein, EBNA1.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		K461 G462 G463 W464 H468 R469 K477 S513 T515 N519 T590
Binding residue
(residue number reindexed from 1)		K1 G2 G3 W4 H8 R9 K17 S53 T55 N59 T130
Enzymatic activity
Enzyme Commision number 3.1.21.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006275 regulation of DNA replication
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1b3t, PDBe:1b3t, PDBj:1b3t
PDBsum1b3t
PubMed9878348
UniProtP03211|EBNA1_EBVB9 Epstein-Barr nuclear antigen 1 (Gene Name=EBNA1)

[Back to BioLiP]