Structure of PDB 1azq Chain A Binding Site BS02

Receptor Information
>1azq Chain A (length=66) Species: 2285 (Sulfolobus acidocaldarius) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDA
PKELLDMLARAEREKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1azq The hyperthermophile chromosomal protein Sac7d sharply kinks DNA.
Resolution1.94 Å
Binding residue
(original residue number in PDB)
Y8 K9 K28 M29 S46
Binding residue
(residue number reindexed from 1)
Y8 K9 K28 M29 S46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004521 RNA endonuclease activity
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:1azq, PDBe:1azq, PDBj:1azq
PDBsum1azq
PubMed9515968
UniProtP13123|DN7D_SULAC DNA-binding protein 7d (Gene Name=Saci_0064)

[Back to BioLiP]