Structure of PDB 1awc Chain A Binding Site BS02

Receptor Information
>1awc Chain A (length=110) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKWGQRKNKPTM
NYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVI
ECEQKKLARM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1awc The structure of GABPalpha/beta: an ETS domain- ankyrin repeat heterodimer bound to DNA.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		Q321 W360 K364 M369 K373 R376 Y380 Y381
Binding residue
(residue number reindexed from 1)		Q2 W41 K45 M50 K54 R57 Y61 Y62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1awc, PDBe:1awc, PDBj:1awc
PDBsum1awc
PubMed9461436
UniProtQ00422|GABPA_MOUSE GA-binding protein alpha chain (Gene Name=Gabpa)

[Back to BioLiP]