Structure of PDB 1au7 Chain A Binding Site BS02

Receptor Information
>1au7 Chain A (length=130) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMRALEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQ
LSFKNACKLKAILSKWLEEAEQKRRTTISIAAKDALERHFGEHSKPSSQE
IMRMAEELNLEKEVVRVWFCNRRQREKRVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1au7 Structure of Pit-1 POU domain bound to DNA as a dimer: unexpected arrangement and flexibility.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		F42 S43 T45 T46 R49 N59 K62 R105 T106 V147 N151
Binding residue
(residue number reindexed from 1)		F38 S39 T41 T42 R45 N55 K58 R75 T76 V117 N121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1au7, PDBe:1au7, PDBj:1au7
PDBsum1au7
PubMed9009203
UniProtP10037|PIT1_RAT Pituitary-specific positive transcription factor 1 (Gene Name=Pou1f1)

[Back to BioLiP]