Structure of PDB 1ais Chain A Binding Site BS02

Receptor Information
>1ais Chain A (length=181) Species: 2262 (Pyrococcus woesei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVDMSKVKLRIENIVASVDLFAQLDLEKVLDLCPNSKYNPEEFPGIICHL
DDPKVALLIFSSGKLVVTGAKSVQDIERAVAKLAQKLKSIGVKFKRAPQI
DVQNMVFSGDIGREFNLDVVALTLPNCEYEPEQFPGVIYRVKEPKSVILL
FSSGKIVCSGAKSEADAWEAVRKLLRELDKY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ais The 2.1-A crystal structure of an archaeal preinitiation complex: TATA-box-binding protein/transcription factor (II)B core/TATA-box.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		E12 N13 E42 F43 H49 L58 T68 V106 P135 F151 S153 K155 V157
Binding residue
(residue number reindexed from 1)		E12 N13 E42 F43 H49 L58 T68 V106 P135 F151 S153 K155 V157
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0140223 general transcription initiation factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ais, PDBe:1ais, PDBj:1ais
PDBsum1ais
PubMed9177165
UniProtP62001|TBP_PYRWO TATA-box-binding protein (Gene Name=tbp)

[Back to BioLiP]