Structure of PDB 1a81 Chain A Binding Site BS02

Receptor Information

>1a81 Chain A (length=254) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHG
RKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFN
RPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLI
ATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLL
HEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVP
CQKI

Ligand information

>1a81 Chain H (length=18) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PDYEPIRKGQRDLYSGLN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1a81 Structural basis for Syk tyrosine kinase ubiquity in signal transduction pathways revealed by the crystal structure of its regulatory SH2 domains bound to a dually phosphorylated ITAM peptide.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	N126 R129
Binding residue (residue number reindexed from 1)	N118 R121

Enzymatic activity

Enzyme Commision number

2.7.10.2: non-specific protein-tyrosine kinase.

Gene Ontology

	Molecular Function
GO:0004715	non-membrane spanning protein tyrosine kinase activity

View graph for
Molecular Function

External links

PDB	RCSB:1a81, PDBe:1a81, PDBj:1a81
PDBsum	1a81
PubMed	9698567
UniProt	P43405\|KSYK_HUMAN Tyrosine-protein kinase SYK (Gene Name=SYK)

[Back to BioLiP]