Structure of PDB 1a66 Chain A Binding Site BS02

Receptor Information

>1a66 Chain A (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKDWQLPSHSGPYELRIEVQPKSHHRARYETEGSRGAVKASAGGHPIVQL
HGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSN
TKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLV
FRVHVPQPSGRTLSLQVASNPIECSQRS

Ligand information

>1a66 Chain C (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

caattttcctcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1a66 Solution structure of the core NFATC1/DNA complex.
Resolution	N/A
Binding residue (original residue number in PDB)	Y29 E32 R127 N128 S129 R142 K143 T145 R177
Binding residue (residue number reindexed from 1)	Y29 E32 R127 N128 S129 R142 K143 T145 R177

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1a66, PDBe:1a66, PDBj:1a66
PDBsum	1a66
PubMed	9506523
UniProt	O95644\|NFAC1_HUMAN Nuclear factor of activated T-cells, cytoplasmic 1 (Gene Name=NFATC1)

[Back to BioLiP]