Structure of PDB 1a34 Chain A Binding Site BS02

Receptor Information
>1a34 Chain A (length=147) Species: 12881 (Satellite tobacco mosaic virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TGDNSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFS
ANFRTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGR
ASNINTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a34 Refined structure of satellite tobacco mosaic virus at 1.8 A resolution.
Resolution1.81 Å
Binding residue
(original residue number in PDB)		V38 A40 R79 S155
Binding residue
(residue number reindexed from 1)		V26 A28 R67 S143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Cellular Component
GO:0019028 viral capsid

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1a34, PDBe:1a34, PDBj:1a34
PDBsum1a34
PubMed9514737
UniProtP17574|COAT_STMV Coat protein

[Back to BioLiP]