Structure of PDB 1a1j Chain A Binding Site BS02

Receptor Information
>1a1j Chain A (length=84) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMRNFSRSDHLTT
HIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a1j High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
F135 D148 S175 K179
Binding residue
(residue number reindexed from 1)
F33 D46 S73 K77
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1a1j, PDBe:1a1j, PDBj:1a1j
PDBsum1a1j
PubMed9562555
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]