Structure of PDB 1a1g Chain A Binding Site BS02

Receptor Information
>1a1g Chain A (length=84) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCRICMRNFSRSDHLTT
HIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a1g High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		S119 S120 T123 D148 S175 K179
Binding residue
(residue number reindexed from 1)		S17 S18 T21 D46 S73 K77
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1a1g, PDBe:1a1g, PDBj:1a1g
PDBsum1a1g
PubMed9562555
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]