Structure of PDB 1a0a Chain A Binding Site BS02

Receptor Information
>1a0a Chain A (length=63) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAA
CRYIRHLQQNGST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a0a Crystal structure of PHO4 bHLH domain-DNA complex: flanking base recognition.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R2 E3 K6 E9 Q10 R13 S41 K42
Binding residue
(residue number reindexed from 1)		R3 E4 K7 E10 Q11 R14 S42 K43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:1a0a, PDBe:1a0a, PDBj:1a0a
PDBsum1a0a
PubMed9303313
UniProtP07270|PHO4_YEAST Phosphate system positive regulatory protein PHO4 (Gene Name=PHO4)

[Back to BioLiP]