Structure of PDB 8oeq Chain 9 Binding Site BS02

Receptor Information
>8oeq Chain 9 (length=126) Species: 5476 (Candida albicans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKISQDVSSSRSKARKAYFTASSVERRVLLSAPLSKELRQQYNVKSLPIR
QNDEVLVVRGSKKGSEGKVNSVYRLKFAIQVDKLQKEKSNGASVPINIHP
SKVVITKLHLDKDRKALIQRKGGKAE
Ligand information
>8oeq Chain 4 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauaugaauugcagauauucgugaaucaucgaaucu
uugaacgcacauugcgcccucugguauuccggagggcaugccuguuugag
cgucguu
.........................................<<<<<<.((
.....>>>.....<.<<<<.....))............>>.>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R12 S13 R16 K17 F20 S24 R28 R51 Q52 V73 Y74 R75 L76 L111 D112 K113 D114 K116 R121
Binding residue
(residue number reindexed from 1)		R11 S12 R15 K16 F19 S23 R27 R50 Q51 V72 Y73 R74 L75 L110 D111 K112 D113 K115 R120
External links