Structure of PDB 7q0f Chain 9 Binding Site BS02

Receptor Information
>7q0f Chain 9 (length=126) Species: 237561 (Candida albicans SC5314) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKISQDVSSSRSKARKAYFTASSVERRVLLSAPLSKELRQQYNVKSLPIR
QNDEVLVVRGSKKGSEGKVNSVYRLKFAIQVDKLQKEKSNGASVPINIHP
SKVVITKLHLDKDRKALIQRKGGKAE
Ligand information
>7q0f Chain 4 (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauaugaauugcagauauucgugaaucaucgaaucu
uugaacgcacauugcgcccucugguauuccggagggcaugccuguuugag
cgucguuu
.........................................<<<<<<.((
.....>>>.....<.<<<<.....))............>>.>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q0f E-site drug specificity of the human pathogen Candida albicans ribosome.
Resolution2.64 Å
Binding residue
(original residue number in PDB)		R12 S13 R16 K17 F20 S24 R28 R51 Q52 V73 Y74 R75 L111 D112 K113 D114 K116 R121
Binding residue
(residue number reindexed from 1)		R11 S12 R15 K16 F19 S23 R27 R50 Q51 V72 Y73 R74 L110 D111 K112 D113 K115 R120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0030445 yeast-form cell wall
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q0f, PDBe:7q0f, PDBj:7q0f
PDBsum7q0f
PubMed35613268
UniProtA0A1D8PCQ5|RL26B_CANAL Large ribosomal subunit protein uL24 (Gene Name=RPL26B)

[Back to BioLiP]