Structure of PDB 8q5i Chain 8 Binding Site BS02

Receptor Information

>8q5i Chain 8 (length=121) Species: 5476 (Candida albicans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KALKVRTSTTFRLPKTLKLTRSPKYQRKSVPHYNRLDAHKIIVAPIATET
AMKKVEDGNTLVFQVDIKSNKHQIKSAVKELYDVDALYVNTLIRPNGTKK
AYIRLTSDYDALDIANRIGYI

Ligand information

>8q5i Chain 4 (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauaugaauugcagauauucgugaaucaucgaaucu
uugaacgcacauugcgcccucugguauuccggagggcaugccuguuugag
cgucguuu

.........................................<<<<<<.((
.....>>>.....<.<<<<.....))............>>.>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
Resolution	2.45 Å
Binding residue (original residue number in PDB)	L24 R27 P35 T37 R42 K49 H53 Y54 N55 R56 K61 K89 H93 Q94
Binding residue (residue number reindexed from 1)	L3 R6 P14 T16 R21 K28 H32 Y33 N34 R35 K40 K68 H72 Q73

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum	8q5i
PubMed
UniProt	A0A8H6F6A1

[Back to BioLiP]